DPCstruct | MC49164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 596 ± 75 aa |
| Standard deviation of domain lengths | 74.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 65.83 |
| Assigned Pfam label(s) | PF07631- PF07626- CL0318- PF07637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351G063 | 1-598 | MIDTPGPQQSGNPYKLLYGLLAIFVWPILCTLACQSLDAAEPSNSPASDPKVTAYLQQYCYRCHGETTRKGDRRFDQLPSQPTAGSA… |
| A0A0H4WIL5 | 10-547 | ASLDLQGGPPDDGNPDPPPIQQDGSLRCDLGSVPADITLQTVAADFARVVHPAMVRESSGCISCHGTTQGRLFTVSSNGLESFYALR… |
| A0A2V8MMC9 | 4-562 | None |
| A6DTF2 | 231-807 | None |
| A6DR41 | 276-882 | None |
| A0A2V8JZE1 | 1-540 | None |
| A0A517RMW8 | 5-661 | None |
| A0A2D4SQU5 | 39-543 | None |
| A0A4V0HYC5 | 3-492 | None |
| A0A2E8F3Z0 | 222-813 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.