DPCstruct | MC49161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0R143 | 71-172 | VLTLELARAMVKWAAVMEMLLLTAAATAVAVVAAQCDPEQLSACVSPIFYGTAPSESCCSNLRAQQKEGCLCQYAKDPTYASYVNNT… |
| P82901 | 1-67 | ACQASQLAVCASAILSGAKPSGECCGNLRAQQPCFCQYAKDPTYGQYIRSPHARDTLQSCGLAVPHC |
| A0A166AUR2 | 7-97 | None |
| A0A251RLK7 | 3-75 | None |
| A0A3Q7FIV4 | 2-99 | None |
| A0A7J0EE70 | 1-92 | None |
| A0A7N2LC52 | 57-155 | None |
| A0A165ZBC4 | 2-92 | None |
| A0A2U1QP27 | 120-234 | None |
| Q3ECX8 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.