DPCstruct | MC49160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 77 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.59 |
| Pfam Score | 49.14 |
| Assigned Pfam label(s) | PF08488- PF13947- CL0001- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0QSN0 | 17-87 | VFSDTYKGMVPTVLDWTVEWKKCEEAKENRTSYACVSSNSYCVDATNGRGYRCKCSDGYKGNPYITDGCEG |
| A0A287V3T8 | 143-211 | VVLDWAVRNVGNCSAARRNATDLACRGELSECFDVANGPGYRCNCSRGYDGNPYLDGGCTDIDECQLKE |
| A0A835HJ58 | 90-156 | None |
| A0A4S4DC34 | 34-129 | None |
| A0A4S4DMU1 | 105-174 | None |
| A0A6S7N7X6 | 20-98 | None |
| A0A068UWB8 | 95-167 | None |
| T1NTC1 | 42-116 | None |
| A0A6G1EAN0 | 295-356 | None |
| A0A022QVL5 | 203-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.