DPCstruct | MC49152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 19.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3ZNL9 | 90-192 | STVEVRLKAVKGGTMFELEHSGLDDEQQWDQFGPGAVGIGWDLVVLGLGVHLAGFKHPEGWESSDEYYKYLAASNEAWRAAYEAAGA… |
| A0A3S9PYD8 | 2-112 | SNVSLSLTPTGSGTVLTLVHEVKDDEHWETFGPAATGIGWDGAFYSLLLYLRGDSNSNPEKMAELSMTPEGLQFVTDTAHAWRNAHI… |
| A0A839QSZ7 | 76-231 | None |
| A0A7V6YBN6 | 27-142 | None |
| A0A022KZ91 | 527-674 | None |
| A0A1X6WTC3 | 101-233 | None |
| A0A4Q7JUJ7 | 866-995 | None |
| A0A840GIV2 | 2-96 | None |
| A0A0U1CVE9 | 35-147 | None |
| A0A285DHY6 | 191-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.