DPCstruct | MC49150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 162 ± 28 aa |
| Standard deviation of domain lengths | 28.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835CW69 | 1-151 | MTTTSEEKDLKCENCEVCAAVKAKYTCPKCEVRTCSLTCAKIHKQSLPCDGIRDKVKFILKDNMTDLDILSDYRFLEEGNFKADLMR… |
| A0A0G2DTY2 | 9-133 | DLCSICNRNAPKYRCPRDSVRTCSLPCYKRHQQWAQCSGKRDPAAFVKRNELATPSGIDHDYNFLTGIERGLQRADENAEAQSHKNK… |
| A0A7S2T214 | 3-147 | None |
| L1LC22 | 2-151 | None |
| A0A3B0MSG0 | 3-157 | None |
| A0A7R8XAG0 | 12-182 | None |
| A0A672PWY0 | 36-193 | None |
| A0A165A5I2 | 7-163 | None |
| D7U7Z4 | 30-149 | None |
| A0A7M3RJT0 | 97-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.