DPCstruct | MC4915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7QZ85 | 43-150 | RRATLSSLLALDRPLSELNQALDALDWSDQPAETLRRTHLAAVLRRYASAELSAEDVAQWASLVESREDLGFEPRHEEAIADALFDL… |
| A0A7R7J9X3 | 42-146 | NRLQALNEIINFGSNLELAAIKIHEFPFDTDEELITINRHHVEKVLKMFISGEISDEQVEQWANFIEGREDLDYDVFGNLIYILANP… |
| A0A4E0Q8K7 | 1-107 | None |
| A0A5E5Q6K5 | 4-99 | None |
| A0A7W7SYU8 | 2-95 | None |
| A0A7X0E1X4 | 4-113 | None |
| A0A840QHH7 | 1-94 | None |
| A0A5R9L3C6 | 51-158 | None |
| A0A450SGB6 | 4-114 | None |
| A0A4Q7KN27 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.