DPCstruct | MC49148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 48.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830CNP1 | 2-105 | NPNAIFLKVNYEQHKAMCYALHVHVLPFFRFYRGAQGKVCSFSCTNSTIKKFKDALAKHGTERCSLGPVKGLDESELLALSSIGQIS… |
| A0A287F0Q2 | 1-105 | MASQIKMQLCRTATDNPNIVFLKVNFDENKPMCKRLNVKVLPFFHFYRGADGQLEAFSCSLAKFQKLKDAIAVHNTDRCSIGPPVGV… |
| A0A816N4W7 | 628-726 | None |
| A0A2P2IZ15 | 1-111 | None |
| A0A6A3BA69 | 1-104 | None |
| A0A4P1R2U6 | 241-363 | None |
| A0A2G2ZCJ0 | 1-98 | None |
| A0A7S3E1W0 | 1-119 | None |
| A0A835C2E4 | 69-177 | None |
| A0A103YG25 | 177-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.