DPCstruct | MC49144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830CDR2 | 9-77 | KMRAAAIMRNEERFTISKCIRILDEMQGVEQTLYFYALDLFENPTARETFVSLKSERRLAWMQGKFRAA |
| A0A2G9HR83 | 54-134 | MLEIAAASKMRATAIMRNEERFTISKCIRVLDEMQSVDQTIYFYALDLFENPSAREIFISLKNERRLAWLQGKFRASSNSA |
| A0A445BIY9 | 48-129 | None |
| A0A438DMK3 | 1-83 | None |
| A0A2Z7BJL0 | 63-131 | None |
| A0A2G9GN28 | 12-85 | None |
| A0A2C9UU52 | 28-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.