DPCstruct | MC4914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 23.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0VUJ2 | 22-212 | GESATLHFKVIASATVDGRPVESSAVMEVTYSKVTHSLIGNGGTTRLYGEALIFDLGGKGTVYILPIRRPPSGSIVYNIYEFNILRT… |
| A0A2P7QNS8 | 14-194 | SLRYRVRLEVETPSGLRQGSSVLESRNISGATGLLRSFQYPSSDCYGEAAIVDLGGGKQLFAVREDAYSSRQIYEMVQRMLAYPPDE… |
| F2ACI2 | 1-145 | None |
| A0A2T5BH92 | 1-119 | None |
| A0A4Q2XEI3 | 2-172 | None |
| A0A257EXI8 | 48-186 | None |
| A0A1Q9AQS9 | 24-205 | None |
| A0A847J5N0 | 5-144 | None |
| A0A2E1Y4N0 | 43-166 | None |
| A0A0Q5CSH8 | 5-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.