DPCstruct | MC49139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 126 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0065- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0X9B4 | 119-235 | TVDMSSEWRTFSNDDQGNDDPSRVGDGPNALLNGAQLNTSIAFGDGMKSRELHRAQNKANLDKGNKGLLQAYKQIGALCDGWQLPGT… |
| A0A835XP00 | 4-116 | LIDDRAEWRTFADQEGLDPSRVGQALHPLLSNLDTTIGWERNDGGLSKAVNRAQARISNPDRKLVAAFREIGLKATLVRANADVEYR… |
| A0A0D2MAW9 | 47-162 | None |
| A0A835LEQ5 | 36-150 | None |
| A0A0U9HN80 | 951-1083 | None |
| A0A7R9GCM7 | 335-467 | None |
| A0A3S5A5D0 | 1-141 | None |
| A0A182UBE7 | 234-367 | None |
| A0A6G1NHF3 | 62-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.