DPCstruct | MC49137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 228 ± 24 aa |
| Standard deviation of domain lengths | 23.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 25.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07850 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830C8Y7 | 5-245 | FIYYPCNFLQTGSLSPSEIGATASVLLGFAPPSTLTSASSSKLNEVLTPNPFDRPRALLMLEVTGAEESQLVADSDESPFSGALRVK… |
| A0A812EL69 | 22-258 | SSQVMGDLLHITHAPGYVKFLEKPTQDLPASDIPKMISHSLGLSSSEMNWNGMLQGSLFKRPKANVIVTIVGHDEMDETPLKPKSIA… |
| A0A090LQ80 | 198-424 | None |
| A0A059B1X8 | 2-203 | None |
| U5D9D0 | 131-372 | None |
| A0A4Y7J6D4 | 34-243 | None |
| A0A182KGB7 | 178-410 | None |
| A0A194RQ10 | 10-192 | None |
| A0A7J6FBM5 | 14-258 | None |
| A0A1I9VZX8 | 45-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.