DPCstruct | MC4913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0620 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q75R51 | 18-81 | PQQRRCPVYRCMACPDGYDLDENGCESCTCKEVKRAVCSPVLCKIYCENGFATGPDGCPICACA |
| A0A821Z5C5 | 1-61 | SISVCPSSFTCKLNCHLGYRTDSNGCLLCECQSCPPMEQCNKNCPSGYLKDLFGCNICECS |
| A0A7M5VAU3 | 20-79 | None |
| A0A4Y7J627 | 11-67 | None |
| A0A3S1A1R2 | 63-118 | None |
| A0A7M5UKG4 | 77-141 | None |
| P38977 | 22-81 | None |
| D2UZG0 | 243-312 | None |
| G3NS44 | 137-197 | None |
| A0A7I8VBR6 | 198-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.