DPCstruct | MC49129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 12.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T7B0 | 1-110 | IYLRHRGRCYYNGSYFWDSRIISRRVDCRINLATLSGGEWIGPAGKMPCPGDKTNIRCSLYQGTAPLRISLYIPNYGGKYLLPSGDG… |
| A0A1X7SI15 | 23-134 | IYLRHNGTCYPNGSYFPDNSIRPTPLQCALLGATLNGGGQWIGPNGTVPCDSGNNVNVQCTTGLGANLSVFINPPSYLGADGDGWYK… |
| A0A1X7T526 | 1-107 | None |
| A0A1X7T298 | 518-646 | None |
| A0A1X7T0C4 | 73-177 | None |
| A0A1X7SZY3 | 243-349 | None |
| A0A1X7SV90 | 1-103 | None |
| A0A1X7TVJ3 | 214-362 | None |
| A0A1X7TSB9 | 212-324 | None |
| A0A1X7TQU1 | 454-563 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.