DPCstruct | MC49127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 84 ± 25 aa |
| Standard deviation of domain lengths | 25.22 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SX44 | 273-345 | SELNPGPMIDDRPNISLLIQWLEPLVNWKQFGCCLPGITYSDISKIEAENKKIDEQKSALYSKWLTVAPKATW |
| A0A1X7TEC4 | 1-69 | PGPMIDDQPACPYFARYLEPLVDWEPFALSLPGGITQLDVDVIKRKGSPYLRMEALHKRWLQANPTASW |
| A0A1X7T5P4 | 66-141 | None |
| A0A1X7T5N9 | 6-76 | None |
| A0A1X7STJ8 | 82-207 | None |
| A0A1X7STH1 | 35-111 | None |
| A0A1X7TLA3 | 1-65 | None |
| A0A1X7TL82 | 27-103 | None |
| A0A1X7UKX3 | 1-72 | None |
| A0A1X7U2S3 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.