DPCstruct | MC49126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 10.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T5B7 | 1-128 | MMIQRVKKHPLTEPLTLFHKNIRKHKYETRQQFTDHVNLIVNNCITYNGFNSELTKTAQRMLEMSNKEINQNSQALEKLEHEINPLL… |
| A0A7R9JIC9 | 238-336 | MDLQTIRENLRQKKYQSREEFLADVNQIVENSTLYNGAKSSLTLAARRMFGLCVERLGEKEDRLMRLEKAINPLLDDNDQVALSFIL… |
| A0A7J5ZS26 | 585-683 | None |
| A0A2I0TBY2 | 1-122 | None |
| A0A0N1PIY6 | 81-179 | None |
| A0A7J7Z5M0 | 46-145 | None |
| A0A1I8JL90 | 313-415 | None |
| A0A2G8JDJ3 | 1-122 | None |
| A0A1S4ER88 | 194-302 | None |
| A0A5S6Q4V2 | 797-898 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.