DPCstruct | MC49125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 169 ± 30 aa |
| Standard deviation of domain lengths | 29.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822E810 | 413-588 | IRIKGEPGRDNQSRARIHKSLPQPFKLKIVINDNFGKQCSLVVEQLNKPLDLITRESYLKSNQSSIKELLAFVYADDCENDGRIFMA… |
| A0A1X7T500 | 63-216 | LKFTFTDQEGDSASLQFEQGNSPLDLATRETRINGWCGKSAEDMLSWSFADDTTSNKRSDFAFYKDSNGQICYRPAPLGNGGQYFYI… |
| A0A816GAE1 | 20-222 | None |
| D2W3F6 | 627-777 | None |
| A0A815SBI0 | 372-543 | None |
| A0A409WCT8 | 19-132 | None |
| A0A814L1F1 | 15-249 | None |
| A0A2P6NZF6 | 387-526 | None |
| A0A814H3J2 | 211-409 | None |
| A0A821D1I0 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.