DPCstruct | MC49122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 268 ± 34 aa |
| Standard deviation of domain lengths | 34.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05667- PF21674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4DLA4 | 7-302 | ILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMSLAQACMDLGYPLELGYQNFLYPS… |
| A0A2I0VKN5 | 1-243 | MDEAHEILLSSLKSSGVSLPVGVSSIKDSSSAALVSICAQSLRLILDSEPSSFPTSLPAATAERFKICAELAAAIKSLGYGEELGFH… |
| D3B059 | 348-653 | None |
| A0A5A8C378 | 6-308 | None |
| A0A822BGG8 | 7-241 | None |
| A0A815A134 | 7-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.