DPCstruct | MC49120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 39.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T211 | 1-120 | MDLSLVTYRAEHINTNAVGKDMDNELRVLQEYQFNCSSTTITSLILGIDVRVATDRRNLYPSVQVFRPNGSLVTGSERTIYYSTSNV… |
| A0A1X7TS35 | 101-234 | GFMELSLLEAKTGSTNNNGQTTAGLAESVETRWIITEKDKWFHCSKKNSKLTEVLVGVDIRTVTGNRNQYPRIEIWREKEGDYKDPV… |
| A0A1X7SWA9 | 1-134 | None |
| A0A1X7SX18 | 1-120 | None |
| A0A1X7TZI1 | 171-308 | None |
| A0A1X7VEX5 | 240-383 | None |
| A0A1X7TLC4 | 192-340 | None |
| A0A1X7TBV9 | 17-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.