DPCstruct | MC49118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 486 ± 95 aa |
| Standard deviation of domain lengths | 94.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0023- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4CK15 | 1-321 | MQALPHVLLLFCPCSGQTFTGINRTDAIILIQTSERARQGRLRATFMQEIQREEERDRKIREEGHQRFTQDQSAVIIQKVWKGHQQR… |
| A0A1X7SXQ6 | 1-496 | MVGLELLEYQYFDDILTDMKLTPSDIEIPIPRYFIMENYRELKEREKILGTVLAKMGPAETEVKEDIDMTTEEAIKLIQIHERARQG… |
| A0A7I0ZXQ9 | 328-802 | None |
| L5K3U9 | 118-643 | None |
| A0A0J7KWE3 | 95-563 | None |
| A0A091DJZ8 | 174-828 | None |
| A0A6J1MY69 | 493-1092 | None |
| A0A4C2A0E9 | 91-499 | None |
| A0A4C1TA14 | 5-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.