DPCstruct | MC49112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SS77 | 157-259 | GTQIKQDNDQLSDENILDMKPQLNDLVRLFDSYAAQFKLIGIALSVRVDDLLPYAEATTNNLIQVFQRWIRRDIDVTWRTILKVCQG… |
| A0A1X7T7A4 | 2-92 | LLEKSPQKGDLHRLFKGSSSHYSTIGIALGVEVNDLLHSPLSASDKLILVFERWIESDNDVTWRNILEVCEDYPKELGKTKSDVEGF… |
| A0A1X7TUW5 | 28-151 | None |
| A0A1X7TXP9 | 283-375 | None |
| A0A1X7TXV4 | 136-233 | None |
| A0A1X7TY52 | 120-221 | None |
| A0A1X7SGC9 | 10-109 | None |
| A0A1X7SGK2 | 2-82 | None |
| A0A1X7SLH4 | 7-104 | None |
| A0A1X7SP81 | 247-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.