DPCstruct | MC4911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444W8W1 | 1-143 | MYTFWPDGGRLHVDSWREVTHVGEYAITITSKQDSNIAEKLFFINLGGYKPGDFEEYHYKTLMVAQTMAEAVKAAKQTTFYKHCGFK… |
| A0A0R0CC80 | 43-156 | HLDSWMTVDGVEQWQVRLSTEAPPADAPKLYFVNLGGYVAGAFGEDHRYLLVVASDTVEAKRKALQQAQAEWIKPHRDALLEVDSCL… |
| A0A3E1K5N7 | 70-194 | None |
| A0A149SWD1 | 9-126 | None |
| A0A1M3CUH1 | 51-181 | None |
| A0A272EXS9 | 90-216 | None |
| A0A522RSE7 | 71-194 | None |
| A0A5Q4GPB6 | 49-172 | None |
| A0A4Q3CFB9 | 111-225 | None |
| A0A2R4NNM3 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.