DPCstruct | MC49106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445A6X4 | 60-163 | TNTVEGFHALDKMKLLKEEAAKIWNDIVTGKAVEDCSMLSRFLLISFADLKKWSFHYWFAFPALMLDPPAALVNLRPASQWLSAAEA… |
| A0A1X7SNE0 | 1-112 | MNTITSFNNIDKKELLDTCGRLILESIKNGDCLKNPSLLTLFLLLTYADLKKYRFDYWFGFPALSPSSPFTYRSISRLDTLFKDSDL… |
| A0A453F1S2 | 107-197 | None |
| A0A224Z511 | 86-197 | None |
| A0A1X7SZ40 | 198-309 | None |
| A0A1X7SNR5 | 3-87 | None |
| A0A0R3R3R6 | 97-199 | None |
| A0A287L389 | 114-212 | None |
| A0A0W8DR71 | 106-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.