DPCstruct | MC4910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 217 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8AZK3 | 3-244 | TKNLNLIFQNYISRFEYLNAPDGADENYKWYAVRNFQNIFDIDAPDFAAMLKQACKATVNLIDSYMQPFGGLVVMAEKCGEAETIRE… |
| A0A7Y3H7H1 | 1-222 | MKVESIKKYAESFKSHLKTSETLDNLYKYENLTNFRAHWDIDELDFYEMYNKSFQSKMSNVLWGGSRNSAKSIMLEFIKLNKEFCRS… |
| A0A2X2T3J0 | 3-212 | None |
| A0A641W2X4 | 132-346 | None |
| A0A2K2UER0 | 188-417 | None |
| A0A7Y1YT39 | 1-181 | None |
| A0A6G3M3B4 | 79-302 | None |
| A0A4Q3HFR5 | 98-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.