DPCstruct | MC491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 383 ± 87 aa |
| Standard deviation of domain lengths | 86.97 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 71.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.42 |
| Pfam Score | 93.29 |
| Assigned Pfam label(s) | CL0123- PF05397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2PMA7 | 16-320 | RQPQQLTQQQPSSQHLLPLFPPVPSAVFATAYPNYCSKAGIHPDPSQLNQDGRQIDLHQLHVEVINLGTFHSIMHNDDAWAIIGGKL… |
| A0A286UAF3 | 3-406 | STPVVNLNHGLDHQTSPEVQNIQEVTQDHTIQLDRALFTALLRIHNQIEPDNMEMQFNGRPIDLFVLYSEVYTLGGITNVQRRDMWA… |
| A0A166DF46 | 653-1061 | None |
| A0A836DAD2 | 303-713 | None |
| A0A0H2RLB2 | 396-877 | None |
| A0A165VNS9 | 1-385 | None |
| A0A4Y9Y3W8 | 182-741 | None |
| A0A401H2A5 | 18-449 | None |
| A0A401H2A6 | 431-911 | None |
| A0A6A4HY03 | 197-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.