DPCstruct | MC49088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 155 ± 22 aa |
| Standard deviation of domain lengths | 21.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SGL8 | 3-149 | VPDSVSKRLCHSLSVFIMSPCCVWIITAGGYVNATGALIANPNIVMLTELVANSKGEWTVGDTLDTNGMNNEEYKKKFQQQLQTGRR… |
| A0A1X7TQ56 | 291-447 | FNMPKNVTERYWYSLSLWSVTPTTNWIIVFGGRTSYSDTAVIELRYTSNNDWSTSIIPLDQYQEKLQERRREWEASQPVQPEDRREI… |
| A0A1X7SLJ3 | 1-131 | None |
| A0A1X7TSJ3 | 281-410 | None |
| A0A1X7TY79 | 238-437 | None |
| A0A1X7TYE7 | 741-918 | None |
| A0A1X7TZD4 | 182-356 | None |
| A0A1X7TZD9 | 255-431 | None |
| A0A1X7T4Z1 | 1-130 | None |
| A0A1X7T0F8 | 99-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.