DPCstruct | MC49085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 236 ± 34 aa |
| Standard deviation of domain lengths | 33.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SEP5 | 9-226 | LSLYFPPLLPPDSVDLDISTMIQTAAVIGLGLVYMSSCNRFMIELMINEIGHSPGPECRFGLNRESYSLSAGLALGMIGLASGDNSV… |
| C1H5G0 | 1422-1660 | LSVHVTRMLPPGAAELNLSPLTQTTGIMGIGLLYCNSQHRRMSEVMLSEMENTEQEEPSISQEILRDEGYRLAAGFALGFINLAKGN… |
| A4I5M6 | 1385-1664 | None |
| A0A7R8XBV7 | 755-1030 | None |
| A0A821I368 | 129-385 | None |
| T1KZR0 | 112-306 | None |
| A0A7J0F274 | 1-165 | None |
| U4UID4 | 213-436 | None |
| A0A3P3Y4U8 | 505-749 | None |
| A0A287FU18 | 443-672 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.