DPCstruct | MC49084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T385 | 1-133 | TSIYALPVKDVCILDEIYEFQWEFSDILNKTKDAFKPKLLSKVIDYLETHVHALLGPNKNNEAAMQGVKEELHNIESIKDLFMVLQR… |
| A0A1X7SE64 | 2-115 | IGELKEVFLDNMHFTKNCFRSIDVSEVIDFVEDYIKLLLSPRFQKPQMIDLIQKEFEHVKTIDQLFKALRRHVSWFNFELVVKLVNT… |
| A0A1X7T314 | 166-282 | None |
| A0A1X7TAR2 | 149-279 | None |
| A0A1X7ST88 | 1-133 | None |
| A0A1X7V8Z1 | 134-283 | None |
| A0A1X7TMH9 | 138-266 | None |
| A0A1X7TL99 | 133-247 | None |
| A0A1X7UG39 | 65-174 | None |
| A0A1X7TXU5 | 12-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.