DPCstruct | MC49082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 65 ± 3 aa |
| Standard deviation of domain lengths | 3.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2XWC0 | 28-94 | MSIQFLLPNRDDAVIWRGPKKNGLIKQFLKDVEWGDLDFLLVDTPPGTSDEHLSVNSFLKESGIDGA |
| A0A1X7SE32 | 1-60 | MSIGFLLNNKDEAVVWRGPKKNAMIKQFLSDVVWGQLDYLIIDTPPGTIDEHISVVENIK |
| A0A504Z476 | 1-65 | None |
| A0A7N2LX19 | 28-94 | None |
| A0A2H1BVI6 | 1-70 | None |
| A0A444BU38 | 1-67 | None |
| A0A843D6A0 | 1-60 | None |
| A0A5B7ILN4 | 1-64 | None |
| A0A7S3AK69 | 15-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.