DPCstruct | MC49076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 131 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0231- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8IK07 | 108-251 | SFPALMQAQKVSRKAASAGFEWDTLDDVWEKVREEVDELRAAYAAAPKAANGKVDAGVAEGDAAAAEQAAASVEDEFGDVLFSLVQV… |
| A0A2N1HUV5 | 15-136 | QKALNTQLECAKLGFDWPEVAPVFDKVLEEIEEVKAEVYAQQRQQDKIEDEIGDLFFAIVNLSRHLEVNPDVALKKANEKFSKRFSL… |
| A0A7C5JR65 | 97-226 | None |
| A0A0W0VDC7 | 149-269 | None |
| A0A437UX62 | 298-429 | None |
| A0A2N6FGR7 | 110-246 | None |
| A0A0W1A0F6 | 3-123 | None |
| A0A7C3DV11 | 63-199 | None |
| A0A533SJS7 | 195-324 | None |
| A0A522U264 | 135-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.