DPCstruct | MC4907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 145 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 17.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5DG68 | 7-164 | KLFLVLFVVVIANSMAQEITSFASMWGMEYYQDDQKITKKDVKDLFSKNEEVYMHWKKADTKEVVAGVALLGQFAVGIWGISELIND… |
| A0A7Y2MS90 | 3-149 | ELNCQDLINKEKLKYHYQSETYGYNDLEDVFRKSDEAYIQYEKFKSSNKKAKIYGLTSLGLIAAGLITVETASEDNCSSGGVCGTKI… |
| A0A7G8ZSJ5 | 184-305 | None |
| A0A7J5W1D2 | 3-154 | None |
| A0A3C0B497 | 2-160 | None |
| A0A2S0RGJ8 | 1-141 | None |
| A0A1E3ZVF7 | 26-172 | None |
| A0A846F9F3 | 1-144 | None |
| A0A1Q3KQ87 | 64-213 | None |
| A0A6L9K7F7 | 138-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.