DPCstruct | MC49069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 315 |
|---|---|
| Mean domain length (aa) | 469 ± 98 aa |
| Standard deviation of domain lengths | 97.90 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.25 |
| Pfam Score | 70.37 |
| Assigned Pfam label(s) | CL0023- CL0041- CL0113- CL0020- PF16095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3PK22 | 34-553 | AKEKKDTISFSLWDYGGQTVFYAMHHLFLTKLGMYVIVFNMREILENEADAINYLRFWINSISLHAPEAPCIFVGTFLDQVADTNNI… |
| K9RIZ4 | 12-377 | PLLIVKNEKQERQCEVNESQLRAEFSNLKEILATNLVTNRGLEEIRKSITYNISKLPHIGTELPKIWVEIRSAIEEDSRNYISREEY… |
| V5DM76 | 123-766 | None |
| R7TB03 | 2-274 | None |
| A0A2R2MT40 | 301-914 | None |
| G4ZD50 | 2-364 | None |
| R7ULG2 | 3-530 | None |
| A0A368F1G6 | 1-296 | None |
| R7Q514 | 438-933 | None |
| A0A1V1X243 | 28-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.