DPCstruct | MC49063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 404 |
|---|---|
| Mean domain length (aa) | 206 ± 46 aa |
| Standard deviation of domain lengths | 45.55 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.65 |
| Pfam Score | 75.86 |
| Assigned Pfam label(s) | CL0023- CL0113- CL0110- PF09782- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9TRS6 | 1-115 | MQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGSARVGYINNQYVLNPTTDELKESSLDLVVAGTAGAVLMVESEADVLS… |
| A0A7S3LLZ3 | 11-221 | CGIRYKVGVPTVDAPMDGHVDVRVHLLPICSPKYESSRPGEESYVIAEFLNRTIEKGKLIDNSELCIQEGKSVYVLYVDIVCLNNDG… |
| A0A099P5E0 | 1-281 | None |
| A0A654HS67 | 299-519 | None |
| A0A1X6PH30 | 135-394 | None |
| K8FF78 | 102-393 | None |
| A0A1B0BK60 | 100-236 | None |
| R9P1V7 | 2-222 | None |
| C3ZZA1 | 11-153 | None |
| A0A6S7G6B9 | 547-768 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.