DPCstruct | MC49061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 98.67 |
| Assigned Pfam label(s) | PF10190- CL0167- CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S8ESB1 | 3-112 | TIQFCPECNNMLYPKEDRAEKKLLLTCRHCEFEKPAENPTVYIHKIKKDTAMRLDLVDPALSGDPTLPRTYDTNCEKCGGNEAVFFM… |
| A0A2C6KP67 | 7-121 | TFCPECNNLLYPKEDRAKRQLMFLCRQCDYIRYAKKDDPDENTAERMAFNFKSKEDIRISMDLAKDPTLGRVSNWRCPKCGDDKAVF… |
| A0A2B4SID3 | 1-148 | None |
| A0A1A9X665 | 322-437 | None |
| A0A5N4A327 | 13-125 | None |
| C4M9T4 | 6-120 | None |
| A0A4W6D5W0 | 5-110 | None |
| F4PUI3 | 150-263 | None |
| A0A3N4KF78 | 21-125 | None |
| L5KHJ6 | 30-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.