DPCstruct | MC4906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2MQY2 | 6-84 | VDPNLFNEVFSLPATERYSFIFRGNAMAIDHILTTPRFHSIVTEVAYGRGNADAPFDFIFDDATLLRSSDHDALVVFVD |
| A0A4Y3VU81 | 12-90 | FSTAISKLTAAGLTDLPAALLDSDRYTYIFDGNSQVLDHLLISPALVTAGYAFDVVHTDSEFTARPTDHDPQIARLTIP |
| A0A399YVW2 | 135-237 | None |
| A0A851HRL8 | 20-136 | None |
| A0A7Y2IS29 | 669-757 | None |
| A0A0B8NZM6 | 48-136 | None |
| A0A1H6EWK8 | 6-82 | None |
| A0A1B8WAQ9 | 306-383 | None |
| A0A3D5Q828 | 89-171 | None |
| A0A7Z9Y0S1 | 344-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.