DPCstruct | MC49059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 32 aa |
| Standard deviation of domain lengths | 31.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4NGG0 | 20-189 | AQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNS… |
| A0A031HK16 | 4-139 | SVVTADHVNRQPTTPGKDPAQSQPYKTEEMRVQLSVRTKVAQGLLTSSTSAGKDSLWVGYTQQSYWQLFSPAISRPFRNTDHEPEIF… |
| A0A0B8NVI0 | 43-157 | None |
| A0A6M4A8D7 | 44-254 | None |
| U5BYM5 | 1-211 | None |
| A0A7X7TVS2 | 16-213 | None |
| A0A4U8TDE4 | 136-291 | None |
| A0A2M7HD36 | 10-152 | None |
| N1NI91 | 1-138 | None |
| A0A0H3L248 | 12-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.