DPCstruct | MC49046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 230 ± 44 aa |
| Standard deviation of domain lengths | 44.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.18 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | PF14711- CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MKV8 | 198-462 | KCRGWRMCLTGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVILYDADRIEQAASTENDKDLYNKQLEIFLN… |
| A0A7Y5RTR5 | 41-261 | QAPACFHSCVGRIRYLGMVLYDADRIHEVAMLPDEKLVEGQRSLILDPKDPEVIRKAQANGIHDDVIEFAQRSPVYRFVKDWGLALP… |
| A0A511D239 | 90-371 | None |
| A0A379ADL9 | 1-149 | None |
| A0A376TGF4 | 39-280 | None |
| A0A485CTN8 | 2-154 | None |
| A0A1J5Q5R7 | 136-416 | None |
| A0A0X3XHW0 | 130-330 | None |
| A0A0H2KH28 | 35-287 | None |
| A0A3N8DXZ3 | 83-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.