DPCstruct | MC49042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 349 ± 35 aa |
| Standard deviation of domain lengths | 35.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5PVF0 | 107-467 | LSPSGNGWNLKVQEFATASAEDLQPIGDDPELAMVRAWERLTRAAKAVARLQPWNWLDETQSFGVLHPVRVELDWASISHGAPGPTF… |
| A0A7C2A6L7 | 2-277 | AVYLGSEGLDGYLKVQSGEIAVDDPDAMHIQKCLMASFEDRDYLEKEELQTIKKLGLKFRGRHAWPQFRSYLPGYVPWYLEKDQAIL… |
| A0A1F1SBB7 | 1-352 | None |
| A0A7X7U1E0 | 4-370 | None |
| A0A1F9N6X0 | 143-579 | None |
| A0A350X144 | 6-376 | None |
| A0A7C6UWE6 | 271-604 | None |
| K1LSW3 | 1-365 | None |
| A0A1V4YT59 | 7-344 | None |
| A0A397R3I3 | 141-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.