DPCstruct | MC4904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 528 ± 71 aa |
| Standard deviation of domain lengths | 70.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G1WDD8 | 584-1135 | ADVTLDAGTDGMSLSLDATMDMGSVDVDFEGLFSISQDEVSASLTGSIDRWDDAFDVSGLNLEDVVMTVGAEKSAAGASMFIGLGAG… |
| A0A6S7HJC8 | 160-705 | PEIIVKISFPALIFELEVKLGSEGLQIGSISGWRFTYMKLIISKQLIGLSLKCKINLDSKNPDSIDSTFTGQVSFTFTGTITISLLW… |
| A0A447CET5 | 1-412 | None |
| A0A523RJU3 | 192-794 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.