DPCstruct | MC49037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 111 ± 23 aa |
| Standard deviation of domain lengths | 23.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9GMF4 | 5-112 | AAPDPAPHPPPTFLEVKCKSSGKTRRFAVGTDAAFALSLINRKLNPSTPLALHIEAFKEGEEPIAFGPNSPLVNYGHGWHLHTLTEL… |
| A0A2Z7BPR8 | 1-102 | MAEDKANTEVKLPPPFVEVECRSSGKILRFSAGTEAGFAVNLINQKLINNNGSDGADNATLASHIEAVKEGEEEPVSFGPNSVLVNY… |
| A0A7J6WBG7 | 196-349 | None |
| A0A7J7KV49 | 1-177 | None |
| A0A7J7DS12 | 61-181 | None |
| A0A2G5EE85 | 7-117 | None |
| A0A7I4BP74 | 2-99 | None |
| A0A835JFK9 | 253-370 | None |
| A0A835HAG6 | 16-102 | None |
| A0A438DI92 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.