DPCstruct | MC49036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 79.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9FYT1 | 45-98 | MANPEVAVAFQNPKIQAAIMDCSQNPLNIVKYQNDKEVMDVFMKISQIFPQING |
| A0A2N9GLG6 | 1-66 | MANPEVALAFQNPRVQAAIMDCSQNPLSIAKYQNDKEVMDVFNKLSELFPGVTAKSSPPQPMVKNM |
| A0A0A9URV9 | 1-54 | None |
| R0H723 | 263-314 | None |
| A0A7S2Z5P0 | 95-146 | None |
| A0A834L6P6 | 446-499 | None |
| A0A2P5XFY7 | 33-86 | None |
| A0A1D6EA40 | 381-434 | None |
| A0A165XK54 | 334-389 | None |
| A0A6J5U163 | 394-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.