DPCstruct | MC49035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 65.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9GGX7 | 1-63 | MVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTELAYR |
| A0A7S4PMT1 | 76-137 | ITQLIKHERIKTTEAKAKELRHFADWIVTLAKKGNLHSRRQALGFVFEKEMVNKAFNEFPAR |
| A0A6L5C598 | 351-412 | None |
| A0A4S8IVG8 | 49-119 | None |
| A0A6A4PR68 | 21-78 | None |
| D8M047 | 25-98 | None |
| A0A5J4ZHE0 | 134-196 | None |
| A0A7J6UXK0 | 18-86 | None |
| A0A287M3B8 | 106-159 | None |
| A0A7S2IM03 | 74-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.