DPCstruct | MC49033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 396 |
|---|---|
| Mean domain length (aa) | 147 ± 32 aa |
| Standard deviation of domain lengths | 32.48 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.75 |
| Pfam Score | 95.85 |
| Assigned Pfam label(s) | CL0481- PF01250- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0L930 | 2-131 | APHVTQRGNRRQDVFFEEADYLFYLETVSYWSQKYGVEVLAYCLMTKHIHLVAVPSTEHGLQEVMRETHLRYARRINFSKGWTGHLW… |
| A0A0M2UWK5 | 14-179 | RLKGYDYTRPGAYFVTICTEGRVCLFGNISGETMQLNAFGRIVQTHWNDLPHHYPQVKLDAFVIMPNHVHGIIILTEIDMVGAGLKP… |
| A0A7H5ET63 | 20-225 | None |
| A0A1G5DW33 | 53-155 | None |
| A0A3N5X6V3 | 46-156 | None |
| A0A239LPL0 | 14-172 | None |
| A0A161JJ01 | 1-119 | None |
| A0A3M1GSA1 | 436-621 | None |
| A0A3L7PMR8 | 225-313 | None |
| A0A7X1E5T4 | 34-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.