DPCstruct | MC49030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 241 ± 35 aa |
| Standard deviation of domain lengths | 34.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8HUA1 | 3-225 | SAQSIRALPRSCREESYEIVRRRLFKDIPGDKFHHRDNTLKQFAKMYRENANDFPQGCADEDYRRKLEKAYPIHPELFDQLYTSWGS… |
| A0A7V2P396 | 240-452 | DKEDIVLHRLFASRRPDDDTIRAYLNVYASNQETFVGTTGGLQKYRDTMVSRYPVHPELLKLAFEAYGRHRHYQHTRGVLAFLADVV… |
| A0A843BMB3 | 211-468 | None |
| A0A7Y8J1Q5 | 1-217 | None |
| A0A7V6DPH2 | 21-330 | None |
| A0A7C1J700 | 393-658 | None |
| A0A1V5KGI5 | 6-268 | None |
| A0A848A8E1 | 432-728 | None |
| A0A6N7AHQ8 | 79-350 | None |
| A0A2M7BMZ4 | 45-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.