DPCstruct | MC49029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 312 ± 64 aa |
| Standard deviation of domain lengths | 63.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8HTX0 | 5-377 | VGSSSLATAATDRSLKLFFTHTGERATITFKRGGKFDGRGLGQINRFLRDWRKNEPANIDPRLLDLVWEVYQRSGSNDYIHIVSAYR… |
| A0A7C2QQ88 | 31-341 | ARDRTISFHSVNTKETLTVQYMRNGKHVPEAMQQINWILRDWRRDEATEMDPALIDLVWEVHNELGSQEPIHVISGFRSRATNDMLR… |
| A0A0Q7YJF7 | 39-405 | None |
| A0A849IBT7 | 7-231 | None |
| A0A4P2QZT2 | 1-371 | None |
| A0A4P2Q896 | 139-550 | None |
| A0A2E7WBJ1 | 739-1088 | None |
| A0A1E3VT36 | 5-316 | None |
| A0A2E7HNW7 | 10-247 | None |
| A0A346R8E0 | 35-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.