DPCstruct | MC49024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 305 ± 43 aa |
| Standard deviation of domain lengths | 43.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IIW4 | 11-286 | YSRYLDDYRKSYFAITRKKAGWDCMRHYEILASGTIPWFLDLNLMPPRQNVFLPKKLLLDAQNLAGVSFHSRAIDFQVFDERKYRRM… |
| A0A094RLL0 | 91-381 | PLNFSFPRPELMPPEIGDRPHFLSSTIPGEPFSFDSWDDYLAEYRSAYFALSTKKGGWDTFRHLEILFSGGIPLMPGLGKAHQHSLA… |
| A0A812L854 | 25-331 | None |
| A0A7S3B3C3 | 5-284 | None |
| A0A812HUT2 | 51-392 | None |
| A0A812YHT2 | 28-334 | None |
| A0A482SBY2 | 110-444 | None |
| A0A1Q9DP81 | 234-550 | None |
| A0A2P6FR80 | 310-593 | None |
| A0A7S1W6K4 | 17-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.