DPCstruct | MC49022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 366 ± 61 aa |
| Standard deviation of domain lengths | 61.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 84.09 |
| Assigned Pfam label(s) | CL0123- PF05499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IHS5 | 6-414 | KLRGSSLRARYEKRPLVNPAHPAGEKFRLWHWERCTSSSQRDASEAALPTNAKETALSVYPFARFNKRLETLRYTDEEYARYIASLP… |
| A0A7J6VW59 | 12-295 | DYSFAKYNKSVDIVKYTDEEYEKYLTDPGWTKEETDQLFDLCGRFDLRFVVIADRFPSSRPVEELKSRYYAVSRAISAARTPTSGDV… |
| A0A6A4JTS0 | 2-251 | None |
| A0A820UHK0 | 48-432 | None |
| A0A4T0HCY0 | 20-385 | None |
| A0A0V0QB85 | 60-456 | None |
| G4T5D3 | 2-472 | None |
| A0A803LEZ9 | 18-347 | None |
| A0A1W0XAF6 | 463-853 | None |
| A0A1Y2HG49 | 23-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.