DPCstruct | MC4902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 178 ± 23 aa |
| Standard deviation of domain lengths | 22.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MAV0 | 1-169 | MDEAYKEFIMQLASWDTRRDFWLQTDYYKQRQSGNARADAAMLDDLINNIQFMPGDAAKSINDSVKLTAETGQDANNLLRQYVAFAS… |
| K8D6E2 | 5-181 | ITALFIVMGLDSRALQEKFLRTSPWVQAQVKEAQGDTESLQRAITLVAQRIKMVSNDNPKAASASPYSSWTLSFTAPKAQDAQRVLK… |
| Q1ZRK1 | 70-263 | None |
| A0A2X4R1E7 | 59-205 | None |
| A0A381G4A8 | 5-212 | None |
| A0A3S5EYZ1 | 9-157 | None |
| K8CFZ6 | 4-212 | None |
| A0A4U9D6G5 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.