DPCstruct | MC49015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5XM12 | 77-196 | GALIEMWLNFLSNNPTLFVFIINLLKGTLIPDRDSAAFISCVGHIDKRKELDRNIKPRDECKYYSALSMMASKVAYENKAYIETIVK… |
| A0A5J5NA99 | 24-143 | GIQIEMLLNLLAINNFLVLLRGKTKKPDKDSAIFISFIGNMDKRMKLDSKIKPEHGCHYYSALSMMASKASYENRAYIETIVKDHWK… |
| A0A4D9C1Z5 | 63-182 | None |
| A0A6A1W509 | 73-194 | None |
| A0A6A6NEX1 | 86-229 | None |
| A0A5A7PDY7 | 60-192 | None |
| A0A5J5TZ88 | 72-218 | None |
| A0A6A2XCH7 | 88-208 | None |
| A0A3Q7FAA0 | 65-209 | None |
| A0A4Y1RV95 | 198-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.