DPCstruct | MC49014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 206 |
|---|---|
| Mean domain length (aa) | 136 ± 34 aa |
| Standard deviation of domain lengths | 34.15 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF17067- PF00425- PF08432- CL0261- CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A2YAP0 | 467-572 | ECNQSNVSAVDCIKAAFPGGSMTGAPKLRSMEHLDSVEGCSRGIYSGSIGFFSYNQTFDLNIVIRNFVIHGDEASIGAGGAIVALSD… |
| A0A7K0XAN4 | 13-111 | IDALFSVFPAGTLSGAPKPRAMEIIELLEPTRRGLYGGAIGYFDFTGNIDACIAIRTALLHGGTAYVQAGAGLVADSDPASENEETL… |
| A0A807ZMB0 | 59-151 | None |
| A0A7J6LF32 | 593-768 | None |
| A0A6L8E7G1 | 41-158 | None |
| A0A845U4K5 | 1-64 | None |
| A0A7S0Y7Y5 | 19-139 | None |
| A0A645J2U3 | 8-88 | None |
| A0A318M3P8 | 252-398 | None |
| A0A7V2UKE9 | 128-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.