DPCstruct | MC49010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.30 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0072- CL0186- PF05997- PF10163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8YTI2 | 2-84 | LYKTDQTLIMTGERERLKELLRTRLIECGWRDQIQMLCRDVVRERGVNNLKLDDLIAEVTAKGRALVPDSVKKELLQKIKVYL |
| A0A5P1E581 | 2-77 | IESGEKEKLMELLRERLIECGWRDEMKALCRAYARKKGRNNVTVDDLIDVITPKGRASVPDSVKAELLQRIRSFLM |
| A0A3P8N6Z7 | 7-80 | None |
| A0A6U3R3Q9 | 9-119 | None |
| T1DG17 | 4-88 | None |
| A0A4U5P0L7 | 1-94 | None |
| A0A7S4E6Y5 | 12-114 | None |
| A0A068UYL2 | 63-167 | None |
| A0A1U8PC65 | 102-194 | None |
| A0A0D8XTZ9 | 355-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.